PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G11960.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 862aa    MW: 96128.7 Da    PI: 6.856
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G11960.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.92.1e-36106183178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv+gC++dls+a++y++rhkvCevh+k+ vv ++++e+rfCqqCsrf  l+efDe+k+sCr+rLa+hn+rrrk q 
  OPUNC01G11960.4 106 CCQVDGCTVDLSSARDYNKRHKVCEVHTKSGVVRIKNVEHRFCQQCSRFQFLQEFDEGKKSCRSRLAQHNRRRRKVQV 183
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-27101168IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.804104181IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-34105184IPR004333Transcription factor, SBP-box
PfamPF031102.9E-28107180IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.65E-5594742IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.205.5E-4602741IPR020683Ankyrin repeat-containing domain
CDDcd002042.74E-4675740No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MASGLKKKGL EWDLNDWRWD SNLFLATPSN ASPSKCSRRE LGRAEGEIDF GVVDKRRRLS  60
PEDDDREECI NAATTNGDDG QIAVQRGRSS EDEMPRQGAC SSSGPCCQVD GCTVDLSSAR  120
DYNKRHKVCE VHTKSGVVRI KNVEHRFCQQ CSRFQFLQEF DEGKKSCRSR LAQHNRRRRK  180
VQVQAGVDVN SLRENHSLSN TLLLLLKQLS GLDSSGPSEQ INGPNHLTNL VKNLAALAGT  240
QRNQDMLKNA NSAAIASHTG NYVANGNSLH DSRPHIPVGT ESTAEEPTVE RRVQNFDLND  300
AYVEGDENRT DKIVFKLFGK EPNDFPSDLR AQILNWLSNC PSDIESYIRP GCIILTIYLR  360
LPNWMWDKLA ADPAHWIQKL ISLSTDDLWR TGWMYARVQD YLTLSCNGSL MLESPWQPAI  420
GNKHQILFIT PIAVACSSTA NFSVKGLNIA QPTTKLLCMF GGKYLIQEAT EKLLDDTRMQ  480
RGPQCLTFSC SFPSTTGRGF IEVEDYDQSS LSFPFVVAEQ DVCSEIRTLE HLLNLVSFDD  540
TLVDRNDLFA SRDRALNFLH EFGWFLQRSH IRATSETPKD CTEGFPAARF RWLLSFAVDL  600
EFCAVVKKLL DTLFQGGVDL DVQSTVEFVL EQDLVFVAVN KRSKPLIDFL LMYTTNSAPM  660
DKTESAAPVQ FLFTPDIAGP SDITPLHIAA TYSDAAGVLD ALTDDPQQLG IKAWKNARDA  720
TGLTPEDYAR KRGHESYIQM VQNKIDSRLP KAHVSVTITS TTSTINTTEK HASRSKPTDQ  780
TTFDVEKGQQ ISAKPPLSCR QCLPELAYRH HSNRFLSTRP AVLSLVAIAA VCVCVGLIMQ  840
GPPHIGGMRG PFRWNSLSSG PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2598180184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15458KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0684710.0AK068471.1 Oryza sativa Japonica Group cDNA clone:J013155F18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614292.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
RefseqXP_015614297.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X3
SwissprotQ9LGU70.0SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A0E0JHD60.0A0A0E0JHD6_ORYPU; Uncharacterized protein
STRINGORGLA01G0103500.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1